PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00022194-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 357aa    MW: 40256.6 Da    PI: 5.1431
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00022194-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1346.4e-11233278449
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                        kr +r   NR +A+rsR RK+ +i eLee v +Le e + L  ++
  PSME_00022194-RA 233 KKRIKRIVANRQSAQRSRIRKLHYISELEESVTALEVEVSILSPQV 278
                       5999********************************9988887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-11230294IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.358232295IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-11234288No hitNo description
Gene3DG3DSA:1.20.5.1707.1E-12234288No hitNo description
PfamPF001701.9E-9234281IPR004827Basic-leucine zipper domain
CDDcd147032.18E-19235286No hitNo description
PROSITE patternPS000360237252IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MASQEDGDNS TGTWGQTTNL PQPLPKNPPF HTIGSSVVDS NYNSFNGWSN SPFHNHNSKN  60
QCLPSMGYLT HFQPQWNDDL IKSPLESPTK KISHRRSGSD SLPFLEAPIN CSADGDELDC  120
RQDVSIALRE SMDFDRLDEK QLMSIFSDIE PFQKQKDQVD GSNVTASSIS GSLASLSDHN  180
GLNDPLMLEA KLNVSGQFRS EPEVDSTCKG EQDNQPVKIE SNETASPDLN VDKKRIKRIV  240
ANRQSAQRSR IRKLHYISEL EESVTALEVE VSILSPQVAF LDHRRATLNI DNSALKERIA  300
ALVQEKIFID EHSEALKTEL QRLEQLYHQQ QQQQMQCKQQ RIEHAISSNT AFDFQQH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-48bZIP family protein